SCOPe 2.03: Domain d1xnrq_: 1xnr Q:

Lineage for d1xnrq_ (1xnr Q:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S17 [50304] (3 species)

7. Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
   Uniprot P24321

8. Domain d1xnrq_: 1xnr Q: [115642]
   Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
   complexed with mg, par, zn

Details for d1xnrq_

PDB Entry: 1xnr, 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

PDB Compounds: (Q:) 16S Ribosomal protein S17

SCOPe Domain Sequences for d1xnrq_:

Sequence; same for both SEQRES and ATOM records:

>d1xnrq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

Timeline for d1xnrq_:

• d1xnrq_ first appeared in SCOP 1.71
  
• d1xnrq_ appears in SCOPe 2.02
  
• d1xnrq_ appears in SCOPe 2.04
  
• d1xnrq_ appears in the current release, SCOPe 2.08