![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
![]() | Protein Ribosomal protein S15 [47065] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) Uniprot P80378 |
![]() | Domain d1xnro_: 1xnr O: [115640] Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_ complexed with mg, par, zn |
PDB Entry: 1xnr (more details), 3.1 Å
SCOPe Domain Sequences for d1xnro_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnro_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d1xnro_: