![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S12 [50302] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries) |
![]() | Domain d1xnrl_: 1xnr L: [115637] Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_ complexed with mg, par, zn |
PDB Entry: 1xnr (more details), 3.1 Å
SCOP Domain Sequences for d1xnrl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnrl_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk pkea
Timeline for d1xnrl_: