Lineage for d1xnrd_ (1xnr D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563589Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2563590Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2563591Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 2563592Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 2563623Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 2563630Domain d1xnrd_: 1xnr D: [115628]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnrd_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center
PDB Compounds: (D:) 16S Ribosomal protein S4

SCOPe Domain Sequences for d1xnrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnrd_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d1xnrd_:

Click to download the PDB-style file with coordinates for d1xnrd_.
(The format of our PDB-style files is described here.)

Timeline for d1xnrd_: