![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
![]() | Protein Ribosomal protein S3 N-terminal domain [54816] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries) |
![]() | Domain d1xnrc1: 1xnr C:2-106 [115626] Other proteins in same PDB: d1xnrb_, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_ complexed with mg, par, zn |
PDB Entry: 1xnr (more details), 3.1 Å
SCOP Domain Sequences for d1xnrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnrc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1xnrc1: