Lineage for d1xnqs_ (1xnq S:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549202Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 2549203Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 2549204Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 2549205Protein Ribosomal protein S19 [54572] (2 species)
  7. 2549233Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 2549238Domain d1xnqs_: 1xnq S: [115622]
    Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqt_, d1xnqv_
    complexed with mg, par, zn

Details for d1xnqs_

PDB Entry: 1xnq (more details), 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center
PDB Compounds: (S:) ribosomal protein s19

SCOPe Domain Sequences for d1xnqs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnqs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d1xnqs_:

Click to download the PDB-style file with coordinates for d1xnqs_.
(The format of our PDB-style files is described here.)

Timeline for d1xnqs_: