SCOPe 2.04: Domain d1xnqr_: 1xnq R:

Lineage for d1xnqr_ (1xnq R:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
   Uniprot P80382

8. Domain d1xnqr_: 1xnq R: [115621]
   Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqs_, d1xnqt_, d1xnqv_
   complexed with mg, par, zn

Details for d1xnqr_

PDB Entry: 1xnq, 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center

PDB Compounds: (R:) ribosomal protein s18

SCOPe Domain Sequences for d1xnqr_:

Sequence; same for both SEQRES and ATOM records:

>d1xnqr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1xnqr_:

• d1xnqr_ first appeared in SCOP 1.71
  
• d1xnqr_ appears in SCOPe 2.03
  
• d1xnqr_ appears in SCOPe 2.05
  
• d1xnqr_ appears in the current release, SCOPe 2.08