Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (2 species) |
Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
Domain d1xnqr_: 1xnq R: [115621] Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqs_, d1xnqt_, d1xnqv_ complexed with mg, par, zn |
PDB Entry: 1xnq (more details), 3.05 Å
SCOPe Domain Sequences for d1xnqr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnqr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d1xnqr_: