Lineage for d1xnqq_ (1xnq Q:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559685Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) (S)
  5. 559965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 560116Protein Ribosomal protein S17 [50304] (2 species)
  7. 560119Species Thermus thermophilus [TaxId:274] [50305] (18 PDB entries)
  8. 560125Domain d1xnqq_: 1xnq Q: [115620]
    Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
    complexed with mg, par, zn

Details for d1xnqq_

PDB Entry: 1xnq (more details), 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center

SCOP Domain Sequences for d1xnqq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnqq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d1xnqq_:

Click to download the PDB-style file with coordinates for d1xnqq_.
(The format of our PDB-style files is described here.)

Timeline for d1xnqq_: