Class a: All alpha proteins [46456] (284 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
Domain d1xnqm_: 1xnq M: [115616] Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_ complexed with mg, par, zn |
PDB Entry: 1xnq (more details), 3.05 Å
SCOPe Domain Sequences for d1xnqm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnqm_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d1xnqm_: