Lineage for d1xnqk_ (1xnq K:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 587067Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 587068Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 587094Protein Ribosomal protein S11 [53141] (1 species)
  7. 587095Species Thermus thermophilus [TaxId:274] [53142] (18 PDB entries)
  8. 587101Domain d1xnqk_: 1xnq K: [115614]
    Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
    complexed with mg, par, zn

Details for d1xnqk_

PDB Entry: 1xnq (more details), 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center

SCOP Domain Sequences for d1xnqk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnqk_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOP Domain Coordinates for d1xnqk_:

Click to download the PDB-style file with coordinates for d1xnqk_.
(The format of our PDB-style files is described here.)

Timeline for d1xnqk_: