SCOPe 2.02: Domain d1xnqj_: 1xnq J:

Lineage for d1xnqj_ (1xnq J:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (2 species)

7. Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
   Uniprot P80375

8. Domain d1xnqj_: 1xnq J: [115613]
   Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
   complexed with mg, par, zn

Details for d1xnqj_

PDB Entry: 1xnq, 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center

PDB Compounds: (J:) ribosomal protein s10

SCOPe Domain Sequences for d1xnqj_:

Sequence; same for both SEQRES and ATOM records:

>d1xnqj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d1xnqj_:

• d1xnqj_ first appeared in SCOP 1.71
  
• d1xnqj_ appears in SCOPe 2.01
  
• d1xnqj_ appears in SCOPe 2.03
  
• d1xnqj_ appears in the current release, SCOPe 2.08