![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
![]() | Protein Ribosomal protein S9 [54218] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries) Uniprot P80374 |
![]() | Domain d1xnqi_: 1xnq I: [115612] Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_ complexed with mg, par, zn |
PDB Entry: 1xnq (more details), 3.05 Å
SCOPe Domain Sequences for d1xnqi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnqi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d1xnqi_: