Lineage for d1xnqe1 (1xnq E:74-154)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537230Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2537278Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 2537306Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. 2537311Domain d1xnqe1: 1xnq E:74-154 [115607]
    Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
    complexed with mg, par, zn

Details for d1xnqe1

PDB Entry: 1xnq (more details), 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center
PDB Compounds: (E:) ribosomal protein s5

SCOPe Domain Sequences for d1xnqe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnqe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d1xnqe1:

Click to download the PDB-style file with coordinates for d1xnqe1.
(The format of our PDB-style files is described here.)

Timeline for d1xnqe1: