Lineage for d1xnqc2 (1xnq C:107-207)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203196Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 1203197Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 1203198Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 1203199Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 1203225Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 1203235Domain d1xnqc2: 1xnq C:107-207 [115605]
    Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
    complexed with mg, par, zn

Details for d1xnqc2

PDB Entry: 1xnq (more details), 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center
PDB Compounds: (C:) ribosomal protein s3

SCOPe Domain Sequences for d1xnqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnqc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1xnqc2:

Click to download the PDB-style file with coordinates for d1xnqc2.
(The format of our PDB-style files is described here.)

Timeline for d1xnqc2: