Lineage for d1xnqc1 (1xnq C:2-106)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602714Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 602741Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 602742Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 602753Protein Ribosomal protein S3 N-terminal domain [54816] (2 species)
  7. 602756Species Thermus thermophilus [TaxId:274] [54817] (18 PDB entries)
  8. 602762Domain d1xnqc1: 1xnq C:2-106 [115604]
    Other proteins in same PDB: d1xnqb_, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
    complexed with mg, par, zn

Details for d1xnqc1

PDB Entry: 1xnq (more details), 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center

SCOP Domain Sequences for d1xnqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnqc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1xnqc1:

Click to download the PDB-style file with coordinates for d1xnqc1.
(The format of our PDB-style files is described here.)

Timeline for d1xnqc1: