Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) fold elaborated with additional structures |
Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
Protein Ribosomal protein S2 [52315] (2 species) |
Species Thermus thermophilus [TaxId:274] [52316] (18 PDB entries) |
Domain d1xnqb_: 1xnq B: [115603] Other proteins in same PDB: d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_ complexed with mg, par, zn |
PDB Entry: 1xnq (more details), 3.05 Å
SCOP Domain Sequences for d1xnqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnqb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d1xnqb_: