Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
Protein p53-binding protein 1, 53BP1, N-terminal domain [418914] (1 species) protein duplication: contains two Tudor domains in tandem |
Species Human (Homo sapiens) [TaxId:9606] [419338] (18 PDB entries) Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
Domain d1xnig1: 1xni G:1485-1537 [115594] Other proteins in same PDB: d1xnia2, d1xnib2, d1xnic2, d1xnid2, d1xnie2, d1xnif2, d1xnig2, d1xnih2, d1xnii2, d1xnij2 |
PDB Entry: 1xni (more details), 2.8 Å
SCOPe Domain Sequences for d1xnig1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnig1 b.34.9.1 (G:1485-1537) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp
Timeline for d1xnig1: