Lineage for d1xnif1 (1xni F:1485-1537)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665781Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 665782Family b.34.9.1: Tudor domain [63749] (7 proteins)
    Pfam PF00567
  6. 665804Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 665805Species Human (Homo sapiens) [TaxId:9606] [110164] (4 PDB entries)
  8. 665820Domain d1xnif1: 1xni F:1485-1537 [115592]

Details for d1xnif1

PDB Entry: 1xni (more details), 2.8 Å

PDB Description: Tandem Tudor Domain of 53BP1
PDB Compounds: (F:) tumor suppressor p53-binding protein 1

SCOP Domain Sequences for d1xnif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnif1 b.34.9.1 (F:1485-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

SCOP Domain Coordinates for d1xnif1:

Click to download the PDB-style file with coordinates for d1xnif1.
(The format of our PDB-style files is described here.)

Timeline for d1xnif1: