Lineage for d1xnic2 (1xni C:1538-1602)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665781Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 665782Family b.34.9.1: Tudor domain [63749] (7 proteins)
    Pfam PF00567
  6. 665804Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 665805Species Human (Homo sapiens) [TaxId:9606] [110164] (4 PDB entries)
  8. 665815Domain d1xnic2: 1xni C:1538-1602 [115587]

Details for d1xnic2

PDB Entry: 1xni (more details), 2.8 Å

PDB Description: Tandem Tudor Domain of 53BP1
PDB Compounds: (C:) tumor suppressor p53-binding protein 1

SCOP Domain Sequences for d1xnic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnic2 b.34.9.1 (C:1538-1602) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqygl

SCOP Domain Coordinates for d1xnic2:

Click to download the PDB-style file with coordinates for d1xnic2.
(The format of our PDB-style files is described here.)

Timeline for d1xnic2: