SCOPe 2.07: Domain d1xn5a_: 1xn5 A:

Lineage for d1xn5a_ (1xn5 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
   Pfam PF05146

6. Protein Hypothetical protein BH1534 [118097] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [118098] (1 PDB entry)
   Uniprot Q9KCN5

8. Domain d1xn5a_: 1xn5 A: [115574]
   Structural genomics target

Details for d1xn5a_

PDB Entry: 1xn5

PDB Description: Solution Structure of Bacillus halodurans Protein BH1534: The Northeast Structural Genomics Consortium Target BhR29

PDB Compounds: (A:) BH1534 unknown conserved protein

SCOPe Domain Sequences for d1xn5a_:

Sequence; same for both SEQRES and ATOM records:

>d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans [TaxId: 86665]}
mtrlpdikkevrfnapiekvweavstseglafwfmendlkaetghhfhlqspfgpspcqv
tdverpiklsftwdtdgwsvtfhlkeeengtiftivhsgwkqgdtkvekagaesavvher
mdrgwhdlvnerlrqive

Timeline for d1xn5a_:

• d1xn5a_ first appeared in SCOP 1.71
  
• d1xn5a_ appears in SCOPe 2.06
  
• d1xn5a_ appears in the current release, SCOPe 2.08