![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.129: TBP-like [55944] (10 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (7 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.5: AHSA1 domain [111168] (7 proteins) Pfam PF05146 |
![]() | Protein Hypothetical protein BH1534 [118097] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [118098] (1 PDB entry) |
![]() | Domain d1xn5a_: 1xn5 A: [115574] Structural genomics target |
PDB Entry: 1xn5 (more details)
SCOP Domain Sequences for d1xn5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans [TaxId: 86665]} mtrlpdikkevrfnapiekvweavstseglafwfmendlkaetghhfhlqspfgpspcqv tdverpiklsftwdtdgwsvtfhlkeeengtiftivhsgwkqgdtkvekagaesavvher mdrgwhdlvnerlrqive
Timeline for d1xn5a_: