SCOP 1.71: Domain d1xn5a_: 1xn5 A:

Lineage for d1xn5a_ (1xn5 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.129: TBP-like [55944] (9 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (6 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: Aha1 domain [111168] (4 proteins)
   Pfam 05146

6. Protein Hypothetical protein BH1534 [118097] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [118098] (1 PDB entry)

8. Domain d1xn5a_: 1xn5 A: [115574]
   Structural genomics target

Details for d1xn5a_

PDB Entry: 1xn5

PDB Description: Solution Structure of Bacillus halodurans Protein BH1534: The Northeast Structural Genomics Consortium Target BhR29

SCOP Domain Sequences for d1xn5a_:

Sequence; same for both SEQRES and ATOM records:

>d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans}
mtrlpdikkevrfnapiekvweavstseglafwfmendlkaetghhfhlqspfgpspcqv
tdverpiklsftwdtdgwsvtfhlkeeengtiftivhsgwkqgdtkvekagaesavvher
mdrgwhdlvnerlrqive

Timeline for d1xn5a_:

• d1xn5a_ is new in SCOP 1.71
  
• d1xn5a_ appears in SCOP 1.73
  
• d1xn5a_ appears in the current release, SCOPe 2.08