Lineage for d1xmya_ (1xmy A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753307Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1753308Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1753393Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1753397Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 1753398Species Human (Homo sapiens) [TaxId:9606] [48550] (28 PDB entries)
    Uniprot Q07343 324-667
  8. 1753443Domain d1xmya_: 1xmy A: [115569]
    complexed with mg, rol, zn

Details for d1xmya_

PDB Entry: 1xmy (more details), 2.4 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With (R)-Rolipram
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d1xmya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmya_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

SCOPe Domain Coordinates for d1xmya_:

Click to download the PDB-style file with coordinates for d1xmya_.
(The format of our PDB-style files is described here.)

Timeline for d1xmya_: