Lineage for d1xmub_ (1xmu B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508381Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1508385Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 1508386Species Human (Homo sapiens) [TaxId:9606] [48550] (28 PDB entries)
    Uniprot Q07343 324-667
  8. 1508412Domain d1xmub_: 1xmu B: [115563]
    complexed with mg, rof, zn

Details for d1xmub_

PDB Entry: 1xmu (more details), 2.3 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With Roflumilast
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d1xmub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmub_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

SCOPe Domain Coordinates for d1xmub_:

Click to download the PDB-style file with coordinates for d1xmub_.
(The format of our PDB-style files is described here.)

Timeline for d1xmub_: