![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (13 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() |
![]() | Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
![]() | Protein Ribosomal protein S20 [46994] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46995] (18 PDB entries) |
![]() | Domain d1xmqt_: 1xmq T: [115549] Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqv_ complexed with mg, par, t6a, zn |
PDB Entry: 1xmq (more details), 3 Å
SCOP Domain Sequences for d1xmqt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmqt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus} rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d1xmqt_: