Lineage for d1xmqs_ (1xmq S:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200309Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1200310Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 1200311Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1200312Protein Ribosomal protein S19 [54572] (2 species)
  7. 1200340Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 1200347Domain d1xmqs_: 1xmq S: [115548]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqt_, d1xmqv_
    complexed with mg, par, zn

Details for d1xmqs_

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1xmqs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d1xmqs_:

Click to download the PDB-style file with coordinates for d1xmqs_.
(The format of our PDB-style files is described here.)

Timeline for d1xmqs_: