SCOP 1.73: Domain d1xmqq_: 1xmq Q:

Lineage for d1xmqq_ (1xmq Q:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S17 [50304] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50305] (36 PDB entries)

8. Domain d1xmqq_: 1xmq Q: [115546]
   Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
   complexed with mg, par, t6a, zn

Details for d1xmqq_

PDB Entry: 1xmq, 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center

PDB Compounds: (Q:) 30S ribosomal protein S17

SCOP Domain Sequences for d1xmqq_:

Sequence; same for both SEQRES and ATOM records:

>d1xmqq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

Timeline for d1xmqq_:

• d1xmqq_ first appeared in SCOP 1.71
  
• d1xmqq_ appears in SCOP 1.75
  
• d1xmqq_ appears in the current release, SCOPe 2.08