![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
![]() | Protein Ribosomal protein S13 [46948] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
![]() | Domain d1xmqm_: 1xmq M: [115542] Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_ complexed with mg, par, t6a, zn |
PDB Entry: 1xmq (more details), 3 Å
SCOP Domain Sequences for d1xmqm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmqm_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d1xmqm_: