Lineage for d1xmqc2 (1xmq C:107-207)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412647Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 1412648Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 1412649Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 1412650Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 1412676Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 1412683Domain d1xmqc2: 1xmq C:107-207 [115531]
    Other proteins in same PDB: d1xmqb_, d1xmqc1, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_
    complexed with mg, par, zn

Details for d1xmqc2

PDB Entry: 1xmq (more details), 3 Å

PDB Description: Crystal Structure of t6A37-ASLLysUUU AAA-mRNA Bound to the Decoding Center
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1xmqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmqc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1xmqc2:

Click to download the PDB-style file with coordinates for d1xmqc2.
(The format of our PDB-style files is described here.)

Timeline for d1xmqc2: