| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
| Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
| Protein Ribosomal protein S2 [52315] (3 species) |
| Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
| Domain d1xmqb_: 1xmq B: [115529] Other proteins in same PDB: d1xmqc1, d1xmqc2, d1xmqd_, d1xmqe1, d1xmqe2, d1xmqf_, d1xmqg_, d1xmqh_, d1xmqi_, d1xmqj_, d1xmqk_, d1xmql_, d1xmqm_, d1xmqn_, d1xmqo_, d1xmqp_, d1xmqq_, d1xmqr_, d1xmqs_, d1xmqt_, d1xmqv_ complexed with mg, par, zn |
PDB Entry: 1xmq (more details), 3 Å
SCOPe Domain Sequences for d1xmqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmqb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d1xmqb_: