Lineage for d1xmor_ (1xmo R:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984966Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1984967Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1984968Protein Ribosomal protein S18 [46913] (2 species)
  7. 1984994Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 1985009Domain d1xmor_: 1xmo R: [115517]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmos_, d1xmot_, d1xmov_
    protein/RNA complex; complexed with mg, par, zn

Details for d1xmor_

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1xmor_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmor_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d1xmor_:

Click to download the PDB-style file with coordinates for d1xmor_.
(The format of our PDB-style files is described here.)

Timeline for d1xmor_: