![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S12 [50302] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries) Uniprot P17293 |
![]() | Domain d1xmol_: 1xmo L: [115511] Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_ complexed with mg, mnu, par, t6a, zn |
PDB Entry: 1xmo (more details), 3.25 Å
SCOP Domain Sequences for d1xmol_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmol_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk pkea
Timeline for d1xmol_: