Lineage for d1xmoj_ (1xmo J:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560593Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 2560594Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 2560595Protein Ribosomal protein S10 [55001] (2 species)
  7. 2560621Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 2560632Domain d1xmoj_: 1xmo J: [115509]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
    protein/RNA complex; complexed with mg, par, zn

Details for d1xmoj_

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d1xmoj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmoj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d1xmoj_:

Click to download the PDB-style file with coordinates for d1xmoj_.
(The format of our PDB-style files is described here.)

Timeline for d1xmoj_: