SCOPe 2.06: Domain d1xmoj_: 1xmo J:

Lineage for d1xmoj_ (1xmo J:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)
   automatically mapped to Pfam PF00338

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (2 species)

7. Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
   Uniprot P80375

8. Domain d1xmoj_: 1xmo J: [115509]
   Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
   protein/RNA complex; complexed with mg, par, zn

Details for d1xmoj_

PDB Entry: 1xmo, 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d1xmoj_:

Sequence; same for both SEQRES and ATOM records:

>d1xmoj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d1xmoj_:

• d1xmoj_ first appeared in SCOP 1.71
  
• d1xmoj_ appears in SCOPe 2.05
  
• d1xmoj_ appears in SCOPe 2.07
  
• d1xmoj_ appears in the current release, SCOPe 2.08