| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
| Protein Ribosomal protein S9 [54218] (2 species) |
| Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries) Uniprot P80374 |
| Domain d1xmoi_: 1xmo I: [115508] Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_ protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 1xmo (more details), 3.25 Å
SCOPe Domain Sequences for d1xmoi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmoi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr
Timeline for d1xmoi_: