Lineage for d1xmoi_ (1xmo I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930061Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2930174Protein Ribosomal protein S9 [54218] (2 species)
  7. 2930202Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
    Uniprot P80374
  8. 2930211Domain d1xmoi_: 1xmo I: [115508]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
    protein/RNA complex; complexed with mg, par, zn

Details for d1xmoi_

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d1xmoi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmoi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOPe Domain Coordinates for d1xmoi_:

Click to download the PDB-style file with coordinates for d1xmoi_.
(The format of our PDB-style files is described here.)

Timeline for d1xmoi_: