Lineage for d1xmog_ (1xmo G:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644314Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 644315Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 644316Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 644317Protein Ribosomal protein S7 [47975] (3 species)
  7. 644322Species Thermus thermophilus [TaxId:274] [47977] (38 PDB entries)
  8. 644336Domain d1xmog_: 1xmo G: [115506]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
    complexed with mg, mnu, par, t6a, zn

Details for d1xmog_

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center
PDB Compounds: (G:) 30S ribosomal protein S7

SCOP Domain Sequences for d1xmog_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmog_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1xmog_:

Click to download the PDB-style file with coordinates for d1xmog_.
(The format of our PDB-style files is described here.)

Timeline for d1xmog_: