SCOPe 2.03: Domain d1xmof_: 1xmo F:

Lineage for d1xmof_ (1xmo F:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
   Uniprot P23370

8. Domain d1xmof_: 1xmo F: [115505]
   Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
   protein/RNA complex; complexed with mg, par, zn

Details for d1xmof_

PDB Entry: 1xmo, 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1xmof_:

Sequence; same for both SEQRES and ATOM records:

>d1xmof_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

Timeline for d1xmof_:

• d1xmof_ first appeared in SCOP 1.71
  
• d1xmof_ appears in SCOPe 2.02
  
• d1xmof_ appears in SCOPe 2.04
  
• d1xmof_ appears in the current release, SCOPe 2.08