Lineage for d1xmoe1 (1xmo E:74-154)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 852986Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 853027Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 853055Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152
    Uniprot P80373
    Uniprot P27152 ! Uniprot P80373
  8. 853071Domain d1xmoe1: 1xmo E:74-154 [115503]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
    complexed with mg, mnu, par, t6a, zn

Details for d1xmoe1

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center
PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d1xmoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmoe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOP Domain Coordinates for d1xmoe1:

Click to download the PDB-style file with coordinates for d1xmoe1.
(The format of our PDB-style files is described here.)

Timeline for d1xmoe1: