SCOPe 2.07: Domain d1xmoc2: 1xmo C:107-207

Lineage for d1xmoc2 (1xmo C:107-207)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
   Uniprot P80372

8. Domain d1xmoc2: 1xmo C:107-207 [115501]
   Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
   protein/RNA complex; complexed with mg, par, zn

Details for d1xmoc2

PDB Entry: 1xmo, 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1xmoc2:

Sequence; same for both SEQRES and ATOM records:

>d1xmoc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d1xmoc2:

• d1xmoc2 first appeared in SCOP 1.71
  
• d1xmoc2 appears in SCOPe 2.06
  
• d1xmoc2 appears in the current release, SCOPe 2.08