Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) automatically mapped to Pfam PF00189 |
Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries) Uniprot P80372 |
Domain d1xmoc2: 1xmo C:107-207 [115501] Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_ protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 1xmo (more details), 3.25 Å
SCOPe Domain Sequences for d1xmoc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmoc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]} qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d1xmoc2: