Lineage for d1xmoc2 (1xmo C:107-207)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947515Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 2947516Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 2947517Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 2947518Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 2947544Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 2947553Domain d1xmoc2: 1xmo C:107-207 [115501]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
    protein/RNA complex; complexed with mg, par, zn

Details for d1xmoc2

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1xmoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmoc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1xmoc2:

Click to download the PDB-style file with coordinates for d1xmoc2.
(The format of our PDB-style files is described here.)

Timeline for d1xmoc2: