SCOPe 2.05: Domain d1xm5c_: 1xm5 C:

Lineage for d1xm5c_ (1xm5 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (4 proteins)
   Pfam PF02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site

6. Protein Hypothetical protein YbeY [118048] (1 species)

7. Species Escherichia coli [TaxId:562] [118049] (1 PDB entry)
   Uniprot P77385

8. Domain d1xm5c_: 1xm5 C: [115469]
   Structural genomics target
   complexed with ni

Details for d1xm5c_

PDB Entry: 1xm5, 2.7 Å

PDB Description: crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054

PDB Compounds: (C:) Hypothetical UPF0054 protein ybeY

SCOPe Domain Sequences for d1xm5c_:

Sequence; same for both SEQRES and ATOM records:

>d1xm5c_ d.92.1.15 (C:) Hypothetical protein YbeY {Escherichia coli [TaxId: 562]}
qvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrgkd
kptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhllgy
dhieddeaeemealeteimlalgyedpy

Timeline for d1xm5c_:

• d1xm5c_ first appeared in SCOP 1.71
  
• d1xm5c_ appears in SCOPe 2.04
  
• d1xm5c_ appears in SCOPe 2.06
  
• d1xm5c_ appears in the current release, SCOPe 2.08