| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.31: ThiG-like [110399] (2 families) ![]() shares the common phosphate-binding site with other superfamilies |
| Family c.1.31.1: ThiG-like [110400] (1 protein) Pfam PF05690 |
| Protein Thiazole biosynthesis protein ThiG [110401] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [110402] (2 PDB entries) Uniprot O31618 |
| Domain d1xm3d_: 1xm3 D: [115464] Structural genomics target |
PDB Entry: 1xm3 (more details), 1.8 Å
SCOPe Domain Sequences for d1xm3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xm3d_ c.1.31.1 (D:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]}
smltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleql
dlskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseq
lleegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpv
ivdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagripl
kqygtassp
Timeline for d1xm3d_: