SCOPe 2.04: Domain d1xlzb_: 1xlz B:

Lineage for d1xlzb_ (1xlz B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (28 PDB entries)
   Uniprot Q07343 324-667

8. Domain d1xlzb_: 1xlz B: [115460]
   complexed with fil, mg, zn

Details for d1xlzb_

PDB Entry: 1xlz, 2.06 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With Filaminast

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d1xlzb_:

Sequence; same for both SEQRES and ATOM records:

>d1xlzb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

Timeline for d1xlzb_:

• d1xlzb_ first appeared in SCOP 1.71
  
• d1xlzb_ appears in SCOPe 2.03
  
• d1xlzb_ appears in SCOPe 2.05
  
• d1xlzb_ appears in the current release, SCOPe 2.08