Lineage for d1xlza_ (1xlz A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285679Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1285680Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1285765Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1285769Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 1285770Species Human (Homo sapiens) [TaxId:9606] [48550] (28 PDB entries)
    Uniprot Q07343 324-667
  8. 1285785Domain d1xlza_: 1xlz A: [115459]
    complexed with fil, mg, zn

Details for d1xlza_

PDB Entry: 1xlz (more details), 2.06 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With Filaminast
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d1xlza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlza_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

SCOPe Domain Coordinates for d1xlza_:

Click to download the PDB-style file with coordinates for d1xlza_.
(The format of our PDB-style files is described here.)

Timeline for d1xlza_: