SCOPe 2.05: Domain d1xkzb_: 1xkz B:

Lineage for d1xkzb_ (1xkz B:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein Regulatory protein BlaR1 [111289] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [111290] (3 PDB entries)
   Uniprot P18357 338-582 ! Uniprot P18357 334-581 ! Uniprot P18357 338-583

8. Domain d1xkzb_: 1xkz B: [115427]
   complexed with caz, epe, so4

Details for d1xkzb_

PDB Entry: 1xkz, 1.75 Å

PDB Description: Crystal structure of the acylated beta-lactam sensor domain of Blar1 from S. aureus

PDB Compounds: (B:) regulatory protein blar1

SCOPe Domain Sequences for d1xkzb_:

Sequence; same for both SEQRES and ATOM records:

>d1xkzb_ e.3.1.1 (B:) Regulatory protein BlaR1 {Staphylococcus aureus [TaxId: 1280]}
dynykkplhndyqildkskifgsnsgsfvmysmkkdkyyiynekesrkryspnstykiyl
amfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipknyta
tqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlssslli
kknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeliseki
lkemgvl

Timeline for d1xkzb_:

• d1xkzb_ first appeared in SCOP 1.71
  
• d1xkzb_ appears in SCOPe 2.04
  
• d1xkzb_ appears in SCOPe 2.06
  
• d1xkzb_ appears in the current release, SCOPe 2.08