![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (11 families) ![]() |
![]() | Family d.2.1.3: Phage lysozyme [53981] (3 proteins) |
![]() | Protein Endolysin Lyz [117758] (1 species) |
![]() | Species Bacteriophage P1 [TaxId:10678] [117759] (2 PDB entries) Uniprot Q37875 1-185 |
![]() | Domain d1xjub_: 1xju B: [115395] structure of secreted inactive form complexed with sul |
PDB Entry: 1xju (more details), 1.07 Å
SCOP Domain Sequences for d1xjub_:
Sequence, based on SEQRES records: (download)
>d1xjub_ d.2.1.3 (B:) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]} rtnqaglelignaegcrrdpymcpagvwtdgignthgvtpgvrktdqqiaadweknilia ercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvn mcnhlpdfvnsngvplrglkirrekerqlcltglvneh
>d1xjub_ d.2.1.3 (B:) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]} rtnqaglelignaegcrrdpymcpagvwtdgiggvtpgvrktdqqiaadwekniliaerc inqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvnmcn hlpdfvnsngvplrglkirrekerqlcltglvneh
Timeline for d1xjub_: