Lineage for d1xjua_ (1xju A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014129Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 1014130Protein Endolysin Lyz [117758] (1 species)
  7. 1014131Species Bacteriophage P1 [TaxId:10678] [117759] (2 PDB entries)
    Uniprot Q37875 1-185
  8. 1014132Domain d1xjua_: 1xju A: [115394]
    structure of secreted inactive form
    complexed with so4

Details for d1xjua_

PDB Entry: 1xju (more details), 1.07 Å

PDB Description: crystal structure of secreted inactive form of p1 phage endolysin lyz
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1xjua_:

Sequence, based on SEQRES records: (download)

>d1xjua_ d.2.1.3 (A:) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]}
rtnqaglelignaegcrrdpymcpagvwtdgignthgvtpgvrktdqqiaadweknilia
ercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvn
mcnhlpdfvnsngvplrglkirrekerqlcltglvneh

Sequence, based on observed residues (ATOM records): (download)

>d1xjua_ d.2.1.3 (A:) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]}
rtnqaglelignaegcrrdpymcpagvwtdgigngvtpgvrktdqqiaadwekniliaer
cinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvnmc
nhlpdfvnsngvplrglkirrekerqlcltglvneh

SCOPe Domain Coordinates for d1xjua_:

Click to download the PDB-style file with coordinates for d1xjua_.
(The format of our PDB-style files is described here.)

Timeline for d1xjua_: