Lineage for d1xiwf_ (1xiw F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764414Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1764434Protein CD3 delta chain ectodomain fragment [117043] (1 species)
  7. 1764435Species Human (Homo sapiens) [TaxId:9606] [117044] (1 PDB entry)
    Uniprot P04234 23-95
  8. 1764437Domain d1xiwf_: 1xiw F: [115372]
    Other proteins in same PDB: d1xiwa_, d1xiwc_, d1xiwd_, d1xiwe_, d1xiwg_, d1xiwh_

Details for d1xiwf_

PDB Entry: 1xiw (more details), 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment
PDB Compounds: (F:) T-cell surface glycoprotein CD3 delta chain

SCOPe Domain Sequences for d1xiwf_:

Sequence, based on SEQRES records: (download)

>d1xiwf_ b.1.1.4 (F:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
kipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcngtdiykdk
estvqvhyrmc

Sequence, based on observed residues (ATOM records): (download)

>d1xiwf_ b.1.1.4 (F:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
kipieeledrvfvncntsitwvegtvgtllsditrldlgkrildprgiyrcnestvqvhy
rmc

SCOPe Domain Coordinates for d1xiwf_:

Click to download the PDB-style file with coordinates for d1xiwf_.
(The format of our PDB-style files is described here.)

Timeline for d1xiwf_: