Lineage for d1xiwa_ (1xiw A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656838Family b.1.1.4: I set domains [49159] (36 proteins)
  6. 656860Protein CD3 epsilon chain ectodomain fragment [69162] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 656861Species Human (Homo sapiens) [TaxId:9606] [110051] (2 PDB entries)
  8. 656862Domain d1xiwa_: 1xiw A: [115367]
    Other proteins in same PDB: d1xiwb_, d1xiwc_, d1xiwd_, d1xiwf_, d1xiwg_, d1xiwh_

Details for d1xiwa_

PDB Entry: 1xiw (more details), 1.9 Å

PDB Description: crystal structure of human cd3-e/d dimer in complex with a ucht1 single-chain antibody fragment
PDB Compounds: (A:) T-cell surface glycoprotein CD3 epsilon chain

SCOP Domain Sequences for d1xiwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
qtpykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedhlslkefseleq
sgyyvcyprgskpedanfylylrarvcencm

SCOP Domain Coordinates for d1xiwa_:

Click to download the PDB-style file with coordinates for d1xiwa_.
(The format of our PDB-style files is described here.)

Timeline for d1xiwa_: